Desulfomicrobium baculatum: Dbac_0066 Help Entry Dbac_0066         CDS       T00963                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dba  Desulfomicrobium baculatum Pathway dba01100   Metabolic pathways dba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dba00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dbac_0066    00074 Mycolic acid biosynthesis     Dbac_0066   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dbac_0066 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 WGG Motif Other DBs NCBI-ProteinID:  ACU88196 UniProt:  C7LSI2 LinkDB All DBs Position complement(89524..89754) Genome browser AA seq 76 aa AA seqDB search MSIEEKVKELVVEQLGVSAEEVKLESSFVESLGADSLDLTELIMAMEEEFDIEIDDEDAQ KIATVQDAINYIKSKS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtctattgaagaaaaagtcaaagaactggttgtcgagcagctgggcgtatccgcggaa gaagtaaagcttgagtcctcctttgtggagtccttgggcgccgattccctggatctgacc gaactgatcatggccatggaagaagaattcgacatcgagatcgatgacgaagacgcacag aagatcgccacagtccaggacgccatcaattatatcaagtccaagtcctag

DBGET integrated database retrieval system