Metallumcola ferriviriculae: MFMK1_000295 Help Entry MFMK1_000295      CDS       T10258                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dbc  Metallumcola ferriviriculae Pathway dbc00020   Citrate cycle (TCA cycle) dbc00720   Other carbon fixation pathways dbc01100   Metabolic pathways dbc01110   Biosynthesis of secondary metabolites dbc01120   Microbial metabolism in diverse environments dbc01200   Carbon metabolism dbc01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dbc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MFMK1_000295   09102 Energy metabolism    00720 Other carbon fixation pathways     MFMK1_000295 Enzymes [BR:dbc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MFMK1_000295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_9 Fer4_6 Fer4_10 Fer4_8 Fer4_17 Fer4_4 Fer4_22 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  WRO20520 UniProt:  A0AAU0UJV1 LinkDB All DBs Position complement(288960..289226) Genome browser AA seq 88 aa AA seqDB search MSSPWKPETHENGTGIFHLFPNLCKGCGLCVEKCPVDTIGWSKKLGVYGTPSVEPGHGEK DCIACGICELVCPDCAILIQKMPKKKEA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagcagtccttggaaacctgaaacgcacgaaaacggtacgggtatctttcatttgttc cccaatctttgcaagggttgtgggttatgcgtagagaaatgccccgtagatacgattggc tggtcaaaaaagttaggcgtatatggcacaccttcggtggaacccggtcatggcgaaaaa gattgtattgcttgtggtatatgcgaactggtatgcccagattgtgccatattgatacaa aaaatgccaaaaaagaaagaagcttag

DBGET integrated database retrieval system