Desulfomarina profundi: DGMP_04450 Help Entry DGMP_04450        CDS       T07650                                  Name (GenBank) hypothetical protein   KO K00794   6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78] Organism dbk  Desulfomarina profundi Pathway dbk00740   Riboflavin metabolism dbk01100   Metabolic pathways dbk01110   Biosynthesis of secondary metabolites dbk01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:dbk00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00740 Riboflavin metabolism     DGMP_04450 Enzymes [BR:dbk01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase      DGMP_04450 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DMRL_synthase Motif Other DBs NCBI-ProteinID:  BCL59752 UniProt:  A0A8D5JKP6 LinkDB All DBs Position 505410..505721 Genome browser AA seq 103 aa AA seqDB search MANIIEGSLKADGKKFAVVVARFNSFISEKLLEGALDSLVRSGALESDIDIVRVPGAFEI PLIAKRLAGSQKYNAVIVLGVVIRGPLPILTLWSMRFPKERPR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcgaatattattgaaggaagccttaaggctgatgggaaaaaatttgcagtagttgtt gcacggtttaactccttcatcagtgaaaaactgcttgaaggggcgttggacagcctggtt cgatcgggagccctggagagcgatattgatatcgtgcgggtgccgggagcatttgaaatt ccgctgattgccaagcgtctggccggttcacagaaatataatgcagtcattgtactgggt gttgttatcagggggccactccccattttgacgttgtggtcaatgaggtttccaaaggaa cggcccaggtag

DBGET integrated database retrieval system