Desulfomarina profundi: DGMP_14240 Help Entry DGMP_14240        CDS       T07650                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism dbk  Desulfomarina profundi Pathway dbk00998   Biosynthesis of various antibiotics dbk01100   Metabolic pathways dbk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dbk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DGMP_14240    00074 Mycolic acid biosynthesis     DGMP_14240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DGMP_14240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCL60731 UniProt:  A0A8D5FSS1 LinkDB All DBs Position complement(1538160..1538411) Genome browser AA seq 83 aa AA seqDB search MTSEEIKDLILEIIEDIDDEADFENLDPDQPLRDQLDLDSMDFLDIVMELRKRHQLQIPE EDYPNLASLNSCVTYLQPLLKDA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacaagtgaagaaattaaagatctaatacttgagatcatagaagatattgatgatgaa gctgattttgagaatcttgatcctgatcaacccctgcgagaccagcttgacctggattca atggattttctggatatagtcatggaacttagaaaacgccaccaattacagatccctgaa gaagattatcccaatctggcgtctctgaacagttgtgtgacctacctccaaccccttctc aaagacgcctga

DBGET integrated database retrieval system