Desulfomarina profundi: DGMP_16740 Help Entry DGMP_16740        CDS       T07650                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism dbk  Desulfomarina profundi Pathway dbk03020   RNA polymerase Brite KEGG Orthology (KO) [BR:dbk00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     DGMP_16740  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dbk03021]     DGMP_16740    03400 DNA repair and recombination proteins [BR:dbk03400]     DGMP_16740 Enzymes [BR:dbk01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      DGMP_16740 Transcription machinery [BR:dbk03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      DGMP_16740 DNA repair and recombination proteins [BR:dbk03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       DGMP_16740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  BCL60981 UniProt:  A0A8D5JRE9 LinkDB All DBs Position complement(1803125..1803400) Genome browser AA seq 91 aa AA seqDB search MARITCEDCLAQIGDDNRFNLIHLTVKRVKQHRQGEPFLVEGKNKEIVMTLREIAAGKVT FENIDILPDLMDGGDSGAVEGDVKEVDTVPA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggctagaattacttgtgaagattgtctggcacagattggagatgacaacagatttaac ctgattcatcttacggtgaaacgtgtcaagcagcatcgtcagggagaaccgtttctcgtg gaagggaagaacaaggaaattgtaatgactcttcgtgaaattgctgcgggaaaagtgact tttgagaacattgacatcctgcctgatttgatggatggaggtgattccggggcagtggaa ggtgatgtcaaagaggttgatacagttcctgcatga

DBGET integrated database retrieval system