Desulfomarina profundi: DGMP_17630 Help Entry DGMP_17630        CDS       T07650                                  Name (GenBank) hypothetical protein   KO K14127   F420-non-reducing hydrogenase iron-sulfur subunit [EC:1.12.99.- 1.8.98.5 1.8.98.6] Organism dbk  Desulfomarina profundi Pathway dbk00680   Methane metabolism dbk01100   Metabolic pathways dbk01120   Microbial metabolism in diverse environments dbk01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:dbk00001]  09100 Metabolism   09102 Energy metabolism    00680 Methane metabolism     DGMP_17630 Enzymes [BR:dbk01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.98  With other, known, physiological acceptors     1.8.98.5  H2:CoB-CoM heterodisulfide,ferredoxin reductase      DGMP_17630     1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase      DGMP_17630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlpD Motif Other DBs NCBI-ProteinID:  BCL61070 UniProt:  A0A8D5JPA4 LinkDB All DBs Position complement(1900986..1901246) Genome browser AA seq 86 aa AA seqDB search MTSDAEMIQESNSPENPGPIPEDWQPNIIAFACHYCAFAAADLAGVMRLPYPTNVKVVRL PCTGKLDHAYLLRAFERGVDGVFAAG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacatctgacgcagaaatgattcaagaatcgaacagtccggagaatccaggacctata ccagaggactggcagccaaatattatcgcttttgcctgtcactactgcgcgtttgctgca gctgaccttgcgggggtaatgaggttgccatatccaaccaatgtgaaggtcgttcgttta ccctgcacggggaaacttgatcacgcctacctgttgagggcttttgaacggggggttgac ggagtgtttgcggcgggctga

DBGET integrated database retrieval system