Desulfomarina profundi: DGMP_23670 Help Entry DGMP_23670        CDS       T07650                                  Symbol acpP-1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dbk  Desulfomarina profundi Pathway dbk00998   Biosynthesis of various antibiotics dbk01100   Metabolic pathways dbk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dbk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DGMP_23670 (acpP-1)    00074 Mycolic acid biosynthesis     DGMP_23670 (acpP-1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DGMP_23670 (acpP-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCL61674 UniProt:  A0A8D5FU07 LinkDB All DBs Position complement(2566812..2567063) Genome browser AA seq 83 aa AA seqDB search MEETKQKIKEILINDLKVQGVTVDGISDTDPLFGEGLELDSLDAVELVVLIQKHFGVQIA DMDEGRKAFESIECLARYILDNK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggaagagacgaaacaaaaaatcaaggaaatattgattaatgatttaaaggtacagggt gttaccgttgacggtatcagtgatactgatccgcttttcggggagggactggaactggat tctctggatgcggttgagctggtggttctgattcagaaacatttcggtgtgcagatagcc gacatggacgaaggccggaaagctttcgaatccattgaatgtcttgcccgctatatcctt gataataaatga

DBGET integrated database retrieval system