Desulfomarina profundi: DGMP_23760 Help Entry DGMP_23760        CDS       T07650                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dbk  Desulfomarina profundi Pathway dbk00998   Biosynthesis of various antibiotics dbk01100   Metabolic pathways dbk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dbk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DGMP_23760 (acpP_2)    00074 Mycolic acid biosynthesis     DGMP_23760 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DGMP_23760 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 HalOD1 HSDR_N_2 Motif Other DBs NCBI-ProteinID:  BCL61683 UniProt:  A0A8D5JDW4 LinkDB All DBs Position complement(2575948..2576211) Genome browser AA seq 87 aa AA seqDB search MISDDELRQKVVEVLAEEFELDPEEMGPEATLYDDLGLDSLDAVDMVVVLEKSFGMKLTD EEALRSIRTMEDLFQFLIRLKKEQEKG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgatttccgacgatgaacttcggcagaaggtagttgaggtcctggcggaagaatttgaa ctggacccggaagaaatgggccctgaggcaaccctgtacgatgatctgggtctggacagc cttgatgcggtggatatggtcgtggttcttgaaaaaagttttggtatgaagctgaccgac gaggaagccctgcgctcaatccgtaccatggaagatctctttcagtttctcatacggttg aaaaaagagcaggaaaaaggctga

DBGET integrated database retrieval system