Desulfomarina profundi: DGMP_28950 Help Entry DGMP_28950        CDS       T07650                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K05788   integration host factor subunit beta Organism dbk  Desulfomarina profundi Brite KEGG Orthology (KO) [BR:dbk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dbk03032]     DGMP_28950 (hup)    03036 Chromosome and associated proteins [BR:dbk03036]     DGMP_28950 (hup)    03400 DNA repair and recombination proteins [BR:dbk03400]     DGMP_28950 (hup) DNA replication proteins [BR:dbk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DGMP_28950 (hup) Chromosome and associated proteins [BR:dbk03036]  Prokaryotic type   Nucleoid associated proteins    IHF (integration host factor)     DGMP_28950 (hup) DNA repair and recombination proteins [BR:dbk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       DGMP_28950 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  BCL62202 UniProt:  A0A8D5FIE4 LinkDB All DBs Position complement(3139130..3139414) Genome browser AA seq 94 aa AA seqDB search MLKKELVDRVSNELAMQKQDIGLAVDILLETMAGALEDNRRIELRGYGSFSVRSRKPRST KNPRTGKIMNIPERKTLHFTMSKSLKEALISETE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgttaaaaaaagaacttgtagacagggtaagtaacgaacttgccatgcagaaacaggat atagggttggcggtggatatcttactggaaacaatggctggggccctggaggataacagg agaatagaactgcgcggatatggcagcttttcggtgagaagcagaaagcccaggtcaacc aaaaacccgcggaccgggaaaatcatgaacattccggagcggaaaacgctccattttacc atgagcaaatccctgaaagaggccctgatcagcgaaacggagtaa

DBGET integrated database retrieval system