Desulfarculus baarsii: Deba_2387 Help Entry Deba_2387         CDS       T01284                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dbr  Desulfarculus baarsii Pathway dbr01100   Metabolic pathways dbr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dbr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Deba_2387    00074 Mycolic acid biosynthesis     Deba_2387   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Deba_2387 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc DUF6137 Motif Other DBs NCBI-ProteinID:  ADK85749 UniProt:  E1QJK6 LinkDB All DBs Position complement(2636114..2636350) Genome browser AA seq 78 aa AA seqDB search MEDIKKKVIQIICEQLSVSEEDVVPKASFVDDLGADSLDLVEMIMAMEEAFDISIADEDA EKIKTVQDAFDYIAKYAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaagatatcaagaaaaaggtaatccagatcatttgtgaacagctttcggtcagcgag gaggacgtggtgcccaaggcctcgttcgtcgacgacctcggcgccgattcgctggacctg gtggaaatgatcatggccatggaggaggcgttcgacatctccatcgccgacgaggacgcc gagaagatcaagaccgtccaggatgctttcgattacatcgccaagtacgccaagtag

DBGET integrated database retrieval system