Solidesulfovibrio carbinolicus: C3Y92_02700 Help Entry C3Y92_02700       CDS       T06503                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dcb  Solidesulfovibrio carbinolicus Pathway dcb01100   Metabolic pathways dcb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dcb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C3Y92_02700    00074 Mycolic acid biosynthesis     C3Y92_02700   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C3Y92_02700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  QAZ66206 UniProt:  A0A4P6HI70 LinkDB All DBs Position complement(613112..613348) Genome browser AA seq 78 aa AA seqDB search MSVAEKVKEIIVDQLGVDAAEVNPDAKFVDDLGADSLDLTELIMAMEEEFGVEISDEDAQ QIQKVQDAISFIEKKKGE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgtcgctgaaaaagtcaaagagatcatcgtggatcagctcggcgtcgatgccgct gaagtcaacccggacgccaagttcgtggacgacctgggcgccgactccctggatctgacc gagcttatcatggccatggaagaggagttcggcgtcgagatctccgacgaggacgcccag cagatccagaaagtccaggacgccatctcctttatcgaaaagaaaaagggcgagtaa

DBGET integrated database retrieval system