Denitrificimonas caeni: O6P33_01595 Help Entry O6P33_01595       CDS       T08709                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism dce  Denitrificimonas caeni Brite KEGG Orthology (KO) [BR:dce00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dce03110]     O6P33_01595 (grxC) Chaperones and folding catalysts [BR:dce03110]  Protein folding catalysts   Protein disulfide isomerase    O6P33_01595 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like CLIC-like_N Thioredoxin_2 TXD17-like_Trx GST_N Motif Other DBs NCBI-ProteinID:  WBE25566 UniProt:  A0AAE9VNU4 LinkDB All DBs Position complement(321179..321433) Genome browser AA seq 84 aa AA seqDB search MAKVVIYCSDWCPFCVRAKTLLSNKGVAFEEIKVDGKPAVRAQMAEKAKRTSVPQIWIDE LHVGGCDELFALERAGKLDALLAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctaaagtagttatctattgcagtgattggtgtcctttctgtgttcgagcaaaaact ttgctgagcaataaaggcgtggcttttgaagaaattaaagtagacggtaagccagctgta cgagcgcaaatggcagaaaaagccaagcgcacgtcggttccacaaatttggattgatgag cttcatgtgggtggctgtgatgagctctttgcgcttgagcgagcaggtaaactggacgct ttgctagccggctag

DBGET integrated database retrieval system