Deinococcus soli (ex Cha et al. 2016): SY84_03770 Help Entry SY84_03770        CDS       T04233                                  Name (GenBank) aspartate decarboxylase   KO K01579   aspartate 1-decarboxylase [EC:4.1.1.11] Organism dch  Deinococcus soli (ex Cha et al. 2016) Pathway dch00410   beta-Alanine metabolism dch00770   Pantothenate and CoA biosynthesis dch01100   Metabolic pathways dch01110   Biosynthesis of secondary metabolites dch01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:dch00001]  09100 Metabolism   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     SY84_03770   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     SY84_03770 Enzymes [BR:dch01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.1  Carboxy-lyases     4.1.1.11  aspartate 1-decarboxylase      SY84_03770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asp_decarbox Motif Other DBs NCBI-ProteinID:  AKH18329 UniProt:  A0A0F7JSF8 LinkDB All DBs Position complement(765725..766075) Genome browser AA seq 116 aa AA seqDB search MFRAKIHRATVTQADLDYVGSITIDQDLLDAADILVNERVDIYNITNGNRLSTYALSGPR GSGVIGINGAAAHLVNPGDLVIIAAYGNYSDEEARTLEPHVVHVDARNRQIQLQPA NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgttcagggccaagattcaccgcgccaccgtcacccaggccgacctcgactacgtcggg agcatcaccatcgaccaggacctgctcgacgcggcggacatcctcgtgaacgaacgggtg gacatctacaacatcaccaacggcaaccgcctgagcacctacgccctgagcggcccgcgc ggcagcggcgtgatcggcatcaacggcgccgccgcgcacctcgtgaaccccggcgacctc gtgatcatcgccgcgtacggcaactacagcgacgaggaagcccgcacgctggaaccgcac gtcgtgcatgtggacgcccgcaaccgtcagatccagctgcagcctgcctga

DBGET integrated database retrieval system