Deinococcus soli (ex Cha et al. 2016): SY84_05325 Help Entry SY84_05325        CDS       T04233                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dch  Deinococcus soli (ex Cha et al. 2016) Pathway dch01100   Metabolic pathways dch01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dch00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SY84_05325    00074 Mycolic acid biosynthesis     SY84_05325   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SY84_05325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AKH16570 UniProt:  A0A0F7JQ11 LinkDB All DBs Position 1083455..1083685 Genome browser AA seq 76 aa AA seqDB search MATFDDVKDVIVDKLGVDADKVSPEARFVEDLGADSLETVELIMGLEDKFGITISDEDAE TIRTVQAAVDYIESKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaacttttgatgatgtgaaagacgtgatcgtggacaagctgggtgtcgacgccgac aaggtgagccccgaagcgcgcttcgtggaggacctgggcgcggacagcctggagaccgtg gaactgatcatgggtctggaagacaagttcggcatcaccatcagcgatgaggacgccgag acgatccgcaccgtgcaggccgctgtcgattacatcgagagcaagcagtaa

DBGET integrated database retrieval system