Diaphorina citri (Asian citrus psyllid): 103508197 Help Entry 103508197         CDS       T07332                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism dci  Diaphorina citri (Asian citrus psyllid) Pathway dci04144   Endocytosis dci04517   IgSF CAM signaling dci04518   Integrin signaling dci05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dci00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103508197    04518 Integrin signaling     103508197  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103508197  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103508197  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dci04131]     103508197    03036 Chromosome and associated proteins [BR:dci03036]     103508197   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dci04147]     103508197    04031 GTP-binding proteins [BR:dci04031]     103508197 Membrane trafficking [BR:dci04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     103508197  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     103508197   Macropinocytosis    Ras GTPases     103508197 Chromosome and associated proteins [BR:dci03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     103508197 Exosome [BR:dci04147]  Exosomal proteins   Exosomal proteins of microglial cells    103508197   Exosomal proteins of breast milk    103508197 GTP-binding proteins [BR:dci04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     103508197 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  103508197 NCBI-ProteinID:  XP_008470953 UniProt:  A0A1S3CZK2 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR EDAPTLEKLAKNKQKPISFEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPPKKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcaaacaatcaagtgtgttgtagttggtgatggagctgtgggtaaaacatgtctgctt atttcatacacaacaaacaaatttccttcagaatatgtaccgacagttttcgataactat gcagtcactgttatgattggaggagaaccatacactttaggtctatttgatacagctggt caagaagattacgacagactacgtccactcagctatcctcagactgatgtttttcttgtt tgcttttctgttgtgtctccatcttcctttgaaaatgtgaaagagaaatgggttccagaa ataacacatcattgtcagaaaacacctttcctcttggtaggaacacaaattgatttgcga gaagatgcccccacactagagaaattagcaaaaaacaaacagaaaccaatctcatttgaa caaggagagaaactggcaaaagaattgaaagcagtcaagtatgtggaatgttcagctctc acacagaaaggcttgaagaatgttttcgatgaagccattcttgcagctctagaacctccc gagccacccaagaaaaggaagtgtgtcctcttgtaa

DBGET integrated database retrieval system