Diaphorina citri (Asian citrus psyllid): 103509001 Help Entry 103509001         CDS       T07332                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dci  Diaphorina citri (Asian citrus psyllid) Pathway dci04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dci00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103509001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dci04121]     103509001    03400 DNA repair and recombination proteins [BR:dci03400]     103509001 Ubiquitin system [BR:dci04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      103509001    Cul5 complex      103509001 DNA repair and recombination proteins [BR:dci03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      103509001 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Motif Other DBs NCBI-GeneID:  103509001 NCBI-ProteinID:  XP_008471815 UniProt:  A0A1S3D0Q7 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MDNLICQLEIIITYLTLLYDKRPRELAGRKTTTVYELKKIIEGITKVPPKDQKLFNKDNR EMEEGNLLQEYGLTSAVAKAQSPALVGLAFRQENGEFEPLELTPYSSPPDLPYVMKASEQ ANGQENITS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggacaatttaatctgtcagttggagataatcatcacctacttaacattgctctatgat aaaagacccagagagttggcgggccgcaaaactaccactgtttatgagttgaaaaagata attgaaggtatcacaaaggttccacccaaggatcaaaaattattcaacaaggataataga gaaatggaggaaggaaatttactgcaagagtatggccttacatctgcagtagcaaaagct caaagtcctgctttggttggcttggcttttagacaagagaatggtgaatttgaacctttg gaactgactccttattcctccccaccagatctgccttatgtaatgaaagcatctgaacaa gcaaatggacaagaaaacatcacttcataa

DBGET integrated database retrieval system