Diaphorina citri (Asian citrus psyllid): 103509067 Help Entry 103509067         CDS       T07332                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism dci  Diaphorina citri (Asian citrus psyllid) Pathway dci04814   Motor proteins Brite KEGG Orthology (KO) [BR:dci00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     103509067  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dci03037]     103509067    04812 Cytoskeleton proteins [BR:dci04812]     103509067 Cilium and associated proteins [BR:dci03037]  Motile cilia and associated proteins   Dynein arm    103509067 Cytoskeleton proteins [BR:dci04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103509067 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF4764 Motif Other DBs NCBI-GeneID:  103509067 NCBI-ProteinID:  XP_008471878 UniProt:  A0A1S3D0U1 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MADTEVVSREEEKKIVHTYPLVHKTDMADELMTEVVDLCSMACEKHAANLEQASRVIKDT MDKKYGPAWHVVVGETFGFEITYECKSLLYMFFGGNLAICMWKCS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcagacactgaggttgtttcccgtgaggaggaaaagaagattgtccacacctatcca ctggttcataaaactgacatggccgatgaactaatgaccgaagtggttgacttatgttcc atggcatgtgagaaacatgctgccaatttggagcaagcatcccgagtcattaaagacaca atggataaaaagtatggacctgcttggcatgtagtagttggagaaacatttggatttgaa ataacatatgagtgtaagagtctattatacatgttctttggtggaaatctggccatctgc atgtggaaatgttcttga

DBGET integrated database retrieval system