Diaphorina citri (Asian citrus psyllid): 103510651 Help Entry 103510651         CDS       T07332                                  Name (RefSeq) calmodulin-alpha   KO K02183   calmodulin Organism dci  Diaphorina citri (Asian citrus psyllid) Pathway dci04070   Phosphatidylinositol signaling system dci04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:dci00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     103510651  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     103510651  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dci01009]     103510651   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dci04131]     103510651    03036 Chromosome and associated proteins [BR:dci03036]     103510651   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dci04147]     103510651 Protein phosphatases and associated proteins [BR:dci01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103510651 Membrane trafficking [BR:dci04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103510651 Chromosome and associated proteins [BR:dci03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103510651 Exosome [BR:dci04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103510651 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH UPF0154 SPARC_Ca_bdg Dockerin_1 EF-hand_11 EFhand_Ca_insen Caleosin FCaBP_EF-hand Poly_export SPEF2_C PhageMin_Tail DUF1103 TerB MotA_activ Fe_hyd_lg_C PA_Ig-like Motif Other DBs NCBI-GeneID:  103510651 NCBI-ProteinID:  XP_026680456 UniProt:  A0A3Q0IW04 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search MDDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEGERK NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggatgatcaattgactgaagagcaaatcgctgaattcaaagaagcgttctcgcttttc gacaaagatggagatggcaccatcaccaccaaagagttgggaaccgtcatgcgatcccta ggacagaaccccacagaagctgagctgcaagacatgattaacgaggtcgatgctgatggc aacggcacgatcgactttcccgagtttctcacgatgatggcgcggaaaatgaaggacacg gacagcgaggaagagatccgggaagcgttccgcgtgttcgacaaggacgggaacgggttc atttctgccgccgagctgaggcacgtcatgaccaatctgggcgagaagctcaccgatgag gaggtcgacgagatgatccgggaggccgacatcgacggagacggccaggtcaactatgaa ggtgagcgaaagtag

DBGET integrated database retrieval system