Diaphorina citri (Asian citrus psyllid): 103519679 Help Entry 103519679         CDS       T07332                                  Name (RefSeq) eclosion hormone-like   KO K28249   eclosion hormone Organism dci  Diaphorina citri (Asian citrus psyllid) Brite KEGG Orthology (KO) [BR:dci00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dci04052]     103519679 Cytokines and neuropeptides [BR:dci04052]  Neuropeptides   Unclassified    103519679 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Eclosion Herpes_U5 Motif Other DBs NCBI-GeneID:  103519679 NCBI-ProteinID:  XP_008482994 UniProt:  A0A1S3DKP9 LinkDB All DBs Position Unknown AA seq 84 aa AA seqDB search MGEIRRSKITVIFVFTFLLLWHTESVVGYFGVCLSNCVQCKEMFGMYFHGRACAESCVKS RGLISPDCNNPNTLRGFLKRYHSD NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgggtgaaataaggcggagtaaaatcacggtgattttcgtgttcacttttctccttctg tggcacacagagagcgtggttgggtactttggggtctgcttatcgaattgcgtccagtgc aaggaaatgttcgggatgtactttcacgggagagcctgtgcagaatcttgcgtcaaaagt cgaggtcttatatcgccagactgcaacaatccgaacactctacgcgggtttctcaaaaga tatcacagcgactag

DBGET integrated database retrieval system