Diaphorina citri (Asian citrus psyllid): 113471636 Help Entry 113471636         CDS       T07332                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism dci  Diaphorina citri (Asian citrus psyllid) Brite KEGG Orthology (KO) [BR:dci00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dci03036]     113471636   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dci04147]     113471636 Chromosome and associated proteins [BR:dci03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113471636 Exosome [BR:dci04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113471636 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-GeneID:  113471636 NCBI-ProteinID:  XP_026686743 UniProt:  A0A1S3DJ13 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MSIMNSFVNDIFERIAAESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcatcatgaacagtttcgtcaacgacattttcgaacgcatcgccgccgagtcctcc cgtctggcccactacaacaagcggtccacgatcacgagtcgggaaatccagactgccgtg cgtctcctgctccccggtgagctggccaagcacgccgtgtccgagggcaccaaggccgtg accaagtacaccagctccaagtaa

DBGET integrated database retrieval system