KEGG   Drechmeria coniospora: 63717508
Entry
63717508          CDS       T11322                                 
Symbol
DCS_04865
Name
(RefSeq) SKP1 component
  KO
K03094  S-phase kinase-associated protein 1
Organism
dcon  Drechmeria coniospora
Pathway
dcon03083  Polycomb repressive complex
dcon04111  Cell cycle - yeast
dcon04120  Ubiquitin mediated proteolysis
dcon04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dcon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    63717508 (DCS_04865)
   04120 Ubiquitin mediated proteolysis
    63717508 (DCS_04865)
  09126 Chromosome
   03083 Polycomb repressive complex
    63717508 (DCS_04865)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    63717508 (DCS_04865)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dcon04131]
    63717508 (DCS_04865)
   04121 Ubiquitin system [BR:dcon04121]
    63717508 (DCS_04865)
   03036 Chromosome and associated proteins [BR:dcon03036]
    63717508 (DCS_04865)
Membrane trafficking [BR:dcon04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    63717508 (DCS_04865)
Ubiquitin system [BR:dcon04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     63717508 (DCS_04865)
   Cul7 complex
     63717508 (DCS_04865)
Chromosome and associated proteins [BR:dcon03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     63717508 (DCS_04865)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     63717508 (DCS_04865)
SSDB
Other DBs
NCBI-GeneID: 63717508
NCBI-ProteinID: XP_040657204
UniProt: A0A151GLH3
LinkDB
Position
02:6412413..6413161
AA seq 172 aa
MADIAAAGPPEKVWLLSNDGVVSDVDRDVIERSVLIKNLLGDTDGKSTKEAPIPILNVNH
AVLTKVLLWCDHHRNDPPQAQDDESDARKKSTDIEDWDQKFMQVDQEMLFEIILAANYLD
IKPLLDVGCKTVANMIKGKSPEEIRKTFNITNDFTPEEEEQIRRENEWAEDR
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccgacatcgcagccgccggacctcccgagaaggtctggctgctttccaacgacggc
gtcgtctctgatgttgaccgagacgtcatcgagcgttcggttctcatcaagaacctgctg
ggcgacacggatgggaagtccaccaaggaagcccccatccccattctcaacgtcaaccac
gcggtcctgaccaaggtccttttgtggtgtgaccatcaccgaaacgacccgccccaggcc
caggacgacgagtccgacgcccgcaagaagagtacggacatcgaagactgggaccagaag
ttcatgcaggtcgatcaagagatgctcttcgagatcatcctcgccgccaactatctcgac
ataaagccccttctcgacgttggctgcaaaaccgtcgccaacatgatcaagggcaagtct
cccgaggagattcgaaagacgttcaacatcacgaacgacttcacccccgaggaggaggag
cagattcgtcgtgagaacgagtgggccgaggaccgataa

DBGET integrated database retrieval system