Demequina capsici: RN607_05340 Help Entry RN607_05340       CDS       T10255                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dcp  Demequina capsici Pathway dcp01100   Metabolic pathways dcp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dcp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RN607_05340    00074 Mycolic acid biosynthesis     RN607_05340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RN607_05340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WNM28427 UniProt:  A0AA96FEX4 LinkDB All DBs Position complement(1110103..1110351) Genome browser AA seq 82 aa AA seqDB search MALSENEVLEGLAEIVVDETGIDAAEVTAEKSFTDDLDIDSLSMMTIVTLAEEKFDVRIP DEDVKNLITVGDAVTYITGAQD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctctgtctgagaacgaggtccttgagggcctggccgagatcgtcgtcgacgagacg ggcatcgacgccgccgaggtcaccgctgagaagtccttcacggacgacctggacatcgac tcgctgtcgatgatgacgatcgtcaccctcgccgaggagaagttcgacgtccgcatcccc gatgaggacgtcaagaacctcatcaccgtgggcgacgccgtcacctacatcacgggtgcc caggactga

DBGET integrated database retrieval system