Daucus carota (carrot): 108196073 Help Entry 108196073         CDS       T05350                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dcr  Daucus carota (carrot) Pathway dcr04145   Phagosome dcr04148   Efferocytosis dcr04517   IgSF CAM signaling dcr04518   Integrin signaling dcr04620   Toll-like receptor signaling pathway dcr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dcr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     108196073    04518 Integrin signaling     108196073  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108196073    04148 Efferocytosis     108196073  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108196073  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108196073  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dcr04131]     108196073   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dcr04147]     108196073    04031 GTP-binding proteins [BR:dcr04031]     108196073 Membrane trafficking [BR:dcr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108196073  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     108196073   Macropinocytosis    Ras GTPases     108196073  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     108196073 Exosome [BR:dcr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108196073   Exosomal proteins of other body fluids (saliva and urine)    108196073   Exosomal proteins of colorectal cancer cells    108196073   Exosomal proteins of bladder cancer cells    108196073 GTP-binding proteins [BR:dcr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108196073 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  108196073 NCBI-ProteinID:  XP_063937095 LinkDB All DBs Position 7:complement(38914357..38918037) Genome browser AA seq 208 aa AA seqDB search MASSVSKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGLTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENILKKWIPELQHFAPGVPVVLAGT KLDLREDKHYLADHPGLVPVTTAQGEELRKQIGAAYYVECSSKTQQNVKAVFDAAIKVVI KPPQKQKEKKKPRQGCLVNVRRKITCLK NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagtgtttcaaagttcataaaatgtgtcactgttggtgatggagctgtggga aagacttgtatgctcatttgttacacaagtaacaaattccccactgattatatcccaaca gtctttgataacttcagtgcaaatgtggtagttgaaggcctaactgtcaacttgggactg tgggacacagctggacaagaagattacaatagattaaggccgttgagttaccgcggggct gatgtctttgtattggctttttcattagttagccgtgcaagctatgagaacatacttaaa aagtggatccctgaacttcaacactttgcccctggagtccctgttgtattggctggtacc aaactggacctccgcgaagataagcactatttagctgatcatccaggtttagtgcccgtg accactgcacagggagaggagctccggaaacagattggtgctgcatattatgttgaatgc agctcaaaaactcaacagaacgtaaaagcagttttcgatgctgctatcaaagtggtgatc aagccaccgcaaaaacaaaaagagaagaagaagccacgccaaggatgtctagtaaatgtc cgcaggaagatcacatgtctcaagtaa

DBGET integrated database retrieval system