Daucus carota (carrot): 108219594 Help Entry 108219594         CDS       T05350                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dcr  Daucus carota (carrot) Pathway dcr04145   Phagosome dcr04148   Efferocytosis dcr04620   Toll-like receptor signaling pathway dcr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dcr00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108219594    04148 Efferocytosis     108219594  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108219594  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108219594  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dcr04131]     108219594   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dcr04147]     108219594    04031 GTP-binding proteins [BR:dcr04031]     108219594 Membrane trafficking [BR:dcr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108219594  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     108219594   Macropinocytosis    Ras GTPases     108219594  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     108219594 Exosome [BR:dcr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108219594   Exosomal proteins of other body fluids (saliva and urine)    108219594   Exosomal proteins of colorectal cancer cells    108219594   Exosomal proteins of bladder cancer cells    108219594 GTP-binding proteins [BR:dcr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108219594 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  108219594 NCBI-ProteinID:  XP_017248596 UniProt:  A0A165Y140 LinkDB All DBs Position 4:complement(42113673..42116662) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTINLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITSAQGEDLKKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKKGQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcaaggttcataaagtgtgtgactgttggtgatggtgctgttggtaagact tgtttgctcatttcctacaccagcaacactttccccacggattacgttccaactgtcttc gacaatttcagtgccaacgtagttgtagatgggagcaccattaaccttggtttatgggat actgctggtcaagaagattacaatagattgagacctttgagctatcgcggagcagatgta tttctcctcgcattttctctgataagcaaagctagctatgaaaatgttgctaagaagtgg attccagaactcaggcattatgcacctggagttcccataattcttgtcggaacaaagctt gatctgagggatgacaagcagttctttgtagaccatcctggtgcagtgcccattacttca gctcaaggagaggatttgaagaaactgatcggggctcctgcatacattgaatgtagttca aagacacagcagaatgtgaaggcagtttttgatgcggctatcaaggtagtgctgcaacca cctaagcaaaagaagaagaagaagaagggccaaaaggcttgttcaatattgtga

DBGET integrated database retrieval system