Daucus carota (carrot): 108220825 Help Entry 108220825         CDS       T05350                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism dcr  Daucus carota (carrot) Brite KEGG Orthology (KO) [BR:dcr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:dcr03041]     108220825   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dcr04052]     108220825 Spliceosome [BR:dcr03041]  Complex B   Other components    Complex B specific factors     108220825 Cytokines and neuropeptides [BR:dcr04052]  Neuropeptides   Unclassified    108220825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  108220825 NCBI-ProteinID:  XP_017250176 UniProt:  A0A162A3A8 LinkDB All DBs Position 5:complement(38692555..38697345) Genome browser AA seq 73 aa AA seqDB search MIEVILNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLQDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtaatattaaacgatcgattggggaaaaaggttcgagtcaagtgcaacgaa gacgacacaatcggtgatctgaagaagctggtggctgcacaaacaggaactagggctgat aaaatcagaattcaaaagtggtacactatttacaaggatcatattactcttcaggactat gagattcatgatggcatgggtctcgaactttactataattag

DBGET integrated database retrieval system