Daucus carota (carrot): 108221002 Help Entry 108221002         CDS       T05350                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism dcr  Daucus carota (carrot) Pathway dcr03018   RNA degradation dcr03040   Spliceosome Brite KEGG Orthology (KO) [BR:dcr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     108221002   09123 Folding, sorting and degradation    03018 RNA degradation     108221002  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dcr03019]     108221002    03041 Spliceosome [BR:dcr03041]     108221002 Messenger RNA biogenesis [BR:dcr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      108221002   mRNA degradation factors    5'-3' decay     Lsm complex      108221002 Spliceosome [BR:dcr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     108221002  Complex C   U2 snRNP components     108221002 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C Motif Other DBs NCBI-GeneID:  108221002 NCBI-ProteinID:  XP_017250393 UniProt:  A0AAF0X4K3 LinkDB All DBs Position 5:34621945..34625278 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPDGVDVDLLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttttcgtattttaaggatttggtaggaagagaagtgaccgttgagttgaag aacgatctggcaatacgaggaacattgcattcagtggaccagtatttgaacatcaagctt gagaatactagggttgttgatcaggacaagtacccccacatgctttcagtccgaaactgt tttattcgaggatctgttgtaaggtatgtccagctaccacctgacggagtggacgttgac ctgctacatgatgccacgagaagagaagcacgtggcggctag

DBGET integrated database retrieval system