Daucus carota (carrot): 108224888
Help
Entry
108224888 CDS
T05350
Name
(RefSeq) CBL-interacting protein kinase 1-like
KO
K03094
S-phase kinase-associated protein 1
Organism
dcr
Daucus carota (carrot)
Pathway
dcr03083
Polycomb repressive complex
dcr04120
Ubiquitin mediated proteolysis
dcr04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
dcr00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
108224888
04120 Ubiquitin mediated proteolysis
108224888
09126 Chromosome
03083 Polycomb repressive complex
108224888
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
dcr04131
]
108224888
04121 Ubiquitin system [BR:
dcr04121
]
108224888
03036 Chromosome and associated proteins [BR:
dcr03036
]
108224888
Membrane trafficking [BR:
dcr04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
108224888
Ubiquitin system [BR:
dcr04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
108224888
Cul7 complex
108224888
Chromosome and associated proteins [BR:
dcr03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
108224888
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
108224888
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NAF
Motif
Other DBs
NCBI-GeneID:
108224888
NCBI-ProteinID:
XP_063936542
LinkDB
All DBs
Position
6:25512532..25516850
Genome browser
AA seq
84 aa
AA seq
DB search
MASSVDLSGFFEKEQDISERTIRFTSHHSPKKLIEGIGFIVTQMGFLFRKRSGQLKVLHF
IKITTVQSVFQLQERNARLLTRIF
NT seq
255 nt
NT seq
+upstream
nt +downstream
nt
atggcctcaagcgtggatctttcaggcttcttcgagaaagagcaggacatttctgagagg
accatcagatttacatctcatcattctccaaaaaaattgattgaggggattggattcatt
gttacacagatgggttttttattccggaagagaagtggacagctgaaagtgctgcatttc
ataaagatcacaacagtccagtcagtctttcagttgcaggagagaaacgcaagacttttg
acgagaattttttga
DBGET
integrated database retrieval system