Daucus carota (carrot): 108225320 Help Entry 108225320         CDS       T05350                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism dcr  Daucus carota (carrot) Pathway dcr03018   RNA degradation dcr03040   Spliceosome Brite KEGG Orthology (KO) [BR:dcr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     108225320   09123 Folding, sorting and degradation    03018 RNA degradation     108225320  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dcr03019]     108225320    03041 Spliceosome [BR:dcr03041]     108225320 Messenger RNA biogenesis [BR:dcr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      108225320   mRNA degradation factors    5'-3' decay     Lsm complex      108225320 Spliceosome [BR:dcr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     108225320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF7452 Motif Other DBs NCBI-GeneID:  108225320 NCBI-ProteinID:  XP_017255648 UniProt:  A0AAF1AF98 LinkDB All DBs Position 6:4284437..4291626 Genome browser AA seq 87 aa AA seqDB search MANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEFTAEGR RVTKLDQILLNGNNIAILVPGGSPDPE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggctaacaacccttcacagcttctcccttcagagctaatagatcgatgtattgggtca aagatttgggtgataatgaaaggagacaaggaacttgttggaactctcagaggttttgat gtttatgtcaacatggttcttgaagatgttactgaatatgaattcactgctgaagggcgt agagtgacaaagctcgaccagatcttgcttaatggaaacaacattgcgattctggtccct ggtggttcccctgatccagaatga

DBGET integrated database retrieval system