Dyella caseinilytica: ISN74_06890 Help Entry ISN74_06890       CDS       T07062                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dcs  Dyella caseinilytica Pathway dcs01100   Metabolic pathways dcs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dcs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ISN74_06890 (acpP)    00074 Mycolic acid biosynthesis     ISN74_06890 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ISN74_06890 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH TMEM210 Motif Other DBs NCBI-ProteinID:  QRN55058 LinkDB All DBs Position 1604579..1604818 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEDEVTANASFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQQAVDYIKAHTKE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgagcagctgggcgtgaaagaa gatgaggtcacggcgaacgcttcgttcgtggacgatctgggcgcggattcgctggacacg gtcgaattggtgatggctctggaagaggaattcgaaaccgaaatccccgacgaagaagcc gaaaagatcaccaccgtgcagcaggccgtggactacatcaaggcccacaccaaggaatga

DBGET integrated database retrieval system