Dendrobium catenatum: 110095808 Help Entry 110095808         CDS       T05027                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dct  Dendrobium catenatum Pathway dct04145   Phagosome dct04148   Efferocytosis dct04620   Toll-like receptor signaling pathway dct05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dct00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110095808    04148 Efferocytosis     110095808  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110095808  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     110095808  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dct04131]     110095808   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dct04147]     110095808    04031 GTP-binding proteins [BR:dct04031]     110095808 Membrane trafficking [BR:dct04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     110095808  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110095808   Macropinocytosis    Ras GTPases     110095808  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     110095808 Exosome [BR:dct04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110095808   Exosomal proteins of other body fluids (saliva and urine)    110095808   Exosomal proteins of colorectal cancer cells    110095808   Exosomal proteins of bladder cancer cells    110095808 GTP-binding proteins [BR:dct04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     110095808 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 B12-binding Sua5_C Motif Other DBs NCBI-GeneID:  110095808 NCBI-ProteinID:  XP_020677160 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELKHYAPGVPIVLVGTKL DLRDDEQFFVDHPGAVPISTAQGEELRKTIGALAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKRKKSQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcatcaaggtttattaagtgcgtgacggttggggatggcgcggtcggcaagacc tgcatgctcatatcttatacaagtaacacgtttcccaccgactatgtgccaacagttttt gacaatttcagtgcaaatgtggtcgttgacggcaacacagtcaacctaggtttgtgggac accgcaggccaggaggattacaatagattaagaccactcagctatcgtggtgctgatgtt ttcctcttagcattctctcttatcagtaaggccagttatgaaaatattgctaagaagtgg attccagagctaaagcactatgctcctggtgttcccatagttcttgttggaacaaagctt gatctgcgggatgatgaacagttttttgtagatcatccaggtgctgttcccatcagtacc gcccagggagaagaactgaggaagacaattggagccctcgcatacattgagtgcagttca aagacacagcaaaatgtcaaggctgtatttgatgcggccatcaaggtagttcttcagcca ccaaaacaaaagaagaaaaggaagaaatcacagaaggcttgctctatcctgtga

DBGET integrated database retrieval system