Dendrobium catenatum: 110109583 Help Entry 110109583         CDS       T05027                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism dct  Dendrobium catenatum Pathway dct03083   Polycomb repressive complex dct04120   Ubiquitin mediated proteolysis dct04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dct00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110109583    04120 Ubiquitin mediated proteolysis     110109583   09126 Chromosome    03083 Polycomb repressive complex     110109583  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dct04131]     110109583    04121 Ubiquitin system [BR:dct04121]     110109583    03036 Chromosome and associated proteins [BR:dct03036]     110109583 Membrane trafficking [BR:dct04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     110109583 Ubiquitin system [BR:dct04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      110109583    Cul7 complex      110109583 Chromosome and associated proteins [BR:dct03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      110109583   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      110109583 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ KorB DUF749 Motif Other DBs NCBI-GeneID:  110109583 NCBI-ProteinID:  XP_020696389 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MSKKIKLKGSDGKRVVVEEEVAMMSETLRHIIEDNLARNVIPISNVTSTVLSYVFQYCKR HLNMDDLEDDLEEFDNEFVDVDVNTLYDLLMAANYLNVKDLLYLVCRKVADLIRGKTPEE IRLTFNIENDLTPEQEEEIRQEHSWAFD NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgtcgaagaagataaaactgaagggctctgatgggaagagagtagtagtggaagaggag gtggccatgatgtctgagaccctccgtcacataattgaagataaccttgcaagaaatgtc attcccatatccaatgtaacttccacggtgctctcttatgtattccaatattgcaagaga cacctcaatatggatgatcttgaggatgatcttgaggagtttgataacgaatttgtcgat gttgacgtgaacaccctttacgatctcctcatggcagcaaattatttgaacgtgaaagac ttgctatatttggtttgccgaaaagtagcggatttgatcagagggaaaaccccagaggaa attcgtctgacattcaacattgaaaatgatctcacgcctgaacaagaggaagagataaga caggaacactcgtgggccttcgactaa

DBGET integrated database retrieval system