Dendrobium catenatum: 110113517 Help Entry 110113517         CDS       T05027                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism dct  Dendrobium catenatum Pathway dct04016   MAPK signaling pathway - plant dct04070   Phosphatidylinositol signaling system dct04075   Plant hormone signal transduction dct04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:dct00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     110113517    04070 Phosphatidylinositol signaling system     110113517    04075 Plant hormone signal transduction     110113517  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     110113517  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dct01009]     110113517   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dct04131]     110113517    03036 Chromosome and associated proteins [BR:dct03036]     110113517   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dct04147]     110113517 Protein phosphatases and associated proteins [BR:dct01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110113517 Membrane trafficking [BR:dct04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110113517 Chromosome and associated proteins [BR:dct03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110113517 Exosome [BR:dct04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110113517 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 Fe_hyd_lg_C PA_Ig-like MecA_N DUF6279 Motif Other DBs NCBI-GeneID:  110113517 NCBI-ProteinID:  XP_020701798 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADELTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELREAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatgagctgacggacgaacagatctctgagttcaaggaggctttcagcttattc gacaaggatggagacggctgcattacaactaaagagttgggcactgtgatgcgttctctt ggccagaatccaacagaagcagaactgcaggacatgattaatgaagtggatgcagatggc aacggaaccattgatttccctgaattcctaaacctcatggctcgcaaaatgaaggacact gactctgaggaggaacttagggaggcttttcgagtctttgataaggaccagaatggtttc atctctgccgccgagctccgccatgttatgaccaacctgggcgaaaagctcaccgatgag gaggttgatgagatgatccgcgaggccgatgttgacggcgacggacagatcaactatgat gagtttgtcaaggtcatgatggccaagtga

DBGET integrated database retrieval system