Dendrobium catenatum: 114579870 Help Entry 114579870         CDS       T05027                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism dct  Dendrobium catenatum Pathway dct03083   Polycomb repressive complex dct04120   Ubiquitin mediated proteolysis dct04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dct00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114579870    04120 Ubiquitin mediated proteolysis     114579870   09126 Chromosome    03083 Polycomb repressive complex     114579870  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dct04131]     114579870    04121 Ubiquitin system [BR:dct04121]     114579870    03036 Chromosome and associated proteins [BR:dct03036]     114579870 Membrane trafficking [BR:dct04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     114579870 Ubiquitin system [BR:dct04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      114579870    Cul7 complex      114579870 Chromosome and associated proteins [BR:dct03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      114579870   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      114579870 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Cpf1_PI-like Motif Other DBs NCBI-GeneID:  114579870 NCBI-ProteinID:  XP_028551605 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MANEMKKMIRMMASDGKEVVVEEAVAMKSEIIRHMIEDNFTEDVIPIPNVTASVLSNIFD YCKKHMDFLPEFEELEDFDNKFVDIDTDALYDLIMAAIIWA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggccaacgagatgaagaagatgataagaatgatggcttctgatggaaaggaggtggtg gtggaagaggcggtagcgatgaagtctgagattatccgtcacatgattgaagacaatttc acagaagatgtcattccaatacccaatgtcaccgcctccgtcctctctaatatctttgat tactgcaagaagcacatggacttcttgcctgaattcgaagagcttgaggactttgataac aaattcgttgacattgataccgatgccctctatgatcttatcatggcagcaattatttgg gcgtga

DBGET integrated database retrieval system