Dendrobium catenatum: 114580463 Help Entry 114580463         CDS       T05027                                  Name (RefSeq) calmodulin-2-like   KO K02183   calmodulin Organism dct  Dendrobium catenatum Pathway dct04016   MAPK signaling pathway - plant dct04070   Phosphatidylinositol signaling system dct04075   Plant hormone signal transduction dct04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:dct00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     114580463    04070 Phosphatidylinositol signaling system     114580463    04075 Plant hormone signal transduction     114580463  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     114580463  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dct01009]     114580463   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dct04131]     114580463    03036 Chromosome and associated proteins [BR:dct03036]     114580463   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dct04147]     114580463 Protein phosphatases and associated proteins [BR:dct01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114580463 Membrane trafficking [BR:dct04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114580463 Chromosome and associated proteins [BR:dct03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114580463 Exosome [BR:dct04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114580463 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 EF-hand_6 AIF-1 EH Dockerin_1 SPARC_Ca_bdg HSM3_N TetR_C_19 DUF3502 RNA_pol_Rpb4 DUF3349 Motif Other DBs NCBI-GeneID:  114580463 NCBI-ProteinID:  XP_028553852 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MRSLGLNPTVMELQDMISKVDADNSGTTDFEEFLNLMESIMKDINFEELVEVFCTLDNDQ DGFISAADLHQVMENLEEKLTDDGVNEIIREADMDGDGQINYKEFETMILAMLDFSLQPM ENML NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgagatcattgggtttaaatccaacagtaatggaattgcaagacatgatcagtaaggtt gacgctgataatagtggcaccactgatttcgaggagttcctgaatcttatggaaagcata atgaaagacattaattttgaggagcttgtggaagtcttctgtacccttgacaacgatcag gatggcttcatttcagcagcagatctccatcaagtgatggaaaaccttgaagagaaacta actgatgatggagttaatgaaattatacgtgaggcagacatggatggagatgggcagatc aactataaggaatttgagacgatgatattagccatgttagatttcagcctccagcctatg gaaaatatgctttaa

DBGET integrated database retrieval system