Dendrobium catenatum: 114580685 Help Entry 114580685         CDS       T05027                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism dct  Dendrobium catenatum Pathway dct04136   Autophagy - other Brite KEGG Orthology (KO) [BR:dct00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     114580685  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dct04131]     114580685    04121 Ubiquitin system [BR:dct04121]     114580685    03029 Mitochondrial biogenesis [BR:dct03029]     114580685 Membrane trafficking [BR:dct04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     114580685 Ubiquitin system [BR:dct04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    114580685 Mitochondrial biogenesis [BR:dct03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     114580685 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  114580685 NCBI-ProteinID:  XP_028554853 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MASELPASDRKVVVHLRATGDAPILKQAKFKKYYEKHKNAPVGKNKMMLLLAHYLRTAIW IMKNDMNLIVNSSS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcgtcagagttgccggcctccgaccgcaaagtggttgttcatcttagggcgaccggc gatgctcccatcctcaagcaggcgaagttcaagaaatattatgagaaacacaaaaatgca cctgttgggaagaataagatgatgcttctgttagcacattacttgagaactgccatttgg ataatgaagaatgatatgaacctaattgtaaacagtagtagttaa

DBGET integrated database retrieval system