Musicola paradisiaca: Dd703_1576 Help Entry Dd703_1576        CDS       T00927                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism dda  Musicola paradisiaca Brite KEGG Orthology (KO) [BR:dda00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:dda03400]     Dd703_1576 DNA repair and recombination proteins [BR:dda03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     Dd703_1576 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI RWD Motif Other DBs NCBI-ProteinID:  ACS85375 UniProt:  C6C3N0 LinkDB All DBs Position complement(1863711..1863953) Genome browser AA seq 80 aa AA seqDB search MRIEITIAKTTLLPTGALDALTKELNRRISSIYPNAPVSIRYASSNNLSVLGGDKSDKER VSEILQETWESADDWFQSNE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgagatcactattgccaaaaccactcttttacccaccggcgccctggatgca ttgactaaagaattaaaccgccggattagtagcatatatccgaatgcgcctgtctctatt cgttacgcttcatccaacaacctgagcgtcctcggcggcgataaaagcgataaggaaagg gtatcggagattttgcaagaaacatgggaaagtgccgatgactggtttcagtctaatgaa taa

DBGET integrated database retrieval system