Musicola paradisiaca: Dd703_3123
Help
Entry
Dd703_3123 CDS
T00927
Name
(GenBank) response regulator receiver modulated diguanylate cyclase
Organism
dda
Musicola paradisiaca
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GGDEF
Response_reg
PDE8A_N
GlnR_1st
Motif
Other DBs
NCBI-ProteinID:
ACS86888
UniProt:
C6CCP5
LinkDB
All DBs
Position
complement(3660336..3661274)
Genome browser
AA seq
312 aa
AA seq
DB search
MWKNMLEQYGQKGMKPKVLIVDDQPINIRILHEVFTEQFDVLMATSGEKALEQVRTQTPD
LILLDIVMPGMDGYEVCRRLKADPLTELIPVIFITSQTEAEVEAYGFEVGAADFISKPIN
PAVVRARVMTQLTLKLYMDNMRDIAWIDGLTGLANRRRFDEMLPGYWQVCRRERRPIALL
MLDVDFFKRYNDSYGHQAGDDCLRQVATAIQQNIRRPMDMCFRYGGEEFACLLPFTDLAG
ACQRAGAILDTVRQLAIPHRASEISDSITLSIGVDCQIPHREDGWNLLLRNADTALYQGK
ALGRDRWVSFTS
NT seq
939 nt
NT seq
+upstream
nt +downstream
nt
atgtggaaaaatatgcttgagcaatatgggcaaaaagggatgaaacccaaggtgctgatc
gtcgacgatcaaccgatcaatatccggattctgcatgaggtattcaccgaacaatttgat
gtgttgatggcgaccagcggcgaaaaagcgctggagcaggtgcgtactcaaacaccggat
ctgatcctgctggatatcgtgatgcctggcatggatggctacgaggtgtgtcggcgttta
aaagccgacccacttaccgaactgatccctgtcatttttattacgtctcagaccgaggcg
gaggtggaagcctatgggtttgaggtaggcgcggcggattttatttctaaaccgattaat
ccagcagtggttcgcgcacgggtgatgacgcaactcaccctgaaactgtatatggacaac
atgcgcgatattgcctggattgacgggttgaccgggttggcgaaccggcggcgtttcgat
gagatgttgccggggtactggcaggtttgtcgtcgggagcgccgtcctatcgcgttgttg
atgctggatgtggatttcttcaaacgttacaacgatagctatgggcatcaggctggcgat
gattgtctacgccaggtcgccacggcgatacagcagaatattcgtcgcccgatggatatg
tgctttcggtatggcggggaggagttcgcttgtttattgccgtttaccgatctggcgggc
gcctgtcagcgtgccggagccattctcgacaccgtccggcagttggcgatcccgcatcgc
gcctcagagatcagcgattccattacattgagtattggtgtggattgccagatccctcac
cgtgaggacgggtggaacctgttgttgcgtaatgcggatactgcgctttatcagggcaag
gctctggggcgggaccggtgggtgagttttacctcgtag
DBGET
integrated database retrieval system