Dickeya dadantii 3937: Dda3937_02280
Help
Entry
Dda3937_02280 CDS
T01305
Name
(GenBank) Two-component response regulator
KO
K07665
two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Organism
ddd
Dickeya dadantii 3937
Pathway
ddd02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
ddd00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
Dda3937_02280
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
ddd02022
]
Dda3937_02280
01504 Antimicrobial resistance genes [BR:
ddd01504
]
Dda3937_02280
Two-component system [BR:
ddd02022
]
OmpR family
CusS-CusR (copper tolerance)
Dda3937_02280
Antimicrobial resistance genes [BR:
ddd01504
]
Gene sets
beta-Lactam resistance modules
Imipenem resistance, repression of porin OprD [MD:
M00745
]
Dda3937_02280
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
Motif
Other DBs
NCBI-ProteinID:
ADM96906
UniProt:
E0SLS2
LinkDB
All DBs
Position
740821..741522
Genome browser
AA seq
233 aa
AA seq
DB search
MRLLLVEDQTMAADYISKGLKENDFVVDVAHDGVDGLHYLLTNDYDLAILDVMLPGMSGW
KILELARQAGKPTPVMFLTARDEVEDRVRGLELGAEDYLIKPFSFSELLARVRVIMRRQA
VHMPAVEESVLQISNLQLDFLKHRVSRGGKRIELTQKEFLLLSLLMRRSGEVLSRTVLAE
QVWDMNFDPETNVIDVAIRRLRSKIDDDYEVKLLHTIRGAGYVLEVRNDADTA
NT seq
702 nt
NT seq
+upstream
nt +downstream
nt
atgagactattgctggtagaagaccaaaccatggcggcggattacatctccaaagggctc
aaggagaatgatttcgtggtcgatgtcgcccacgatggcgtggatggcctgcattatctg
ctgaccaacgattatgatctggcgatcctcgacgtcatgctgcccggtatgagcggctgg
aaaattctggagctggcgcgtcaggccgggaaaccgaccccggtcatgttcctgacggcg
cgcgacgaggtagaggaccgggtgcgtggtctggagctgggcgcggaagattatctgatc
aaacccttttcctttagcgaactgctggcgcgggtgcgcgtgattatgcggcggcaggcg
gtacatatgccggcggtagaggagtccgtgctgcaaatcagcaacttgcagttggatttc
ttgaaacatcgcgtgtcgcgcggtgggaaacgcatcgagctgacgcaaaaagaatttttg
ctgttgagcctgttgatgcgtcgcagcggcgaagtgctgtcgcgcaccgtgctggcggag
caggtttgggacatgaattttgaccctgaaacgaacgtcattgacgtggcgattcgccgg
ctgcgcagcaaaatcgatgatgattatgaggtcaaactgctgcacaccatccgcggcgcc
ggatatgtcctggaagtgagaaatgatgctgataccgcgtaa
DBGET
integrated database retrieval system