Oleidesulfovibrio alaskensis: Dde_0980 Help Entry Dde_0980          CDS       T00294                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism dde  Oleidesulfovibrio alaskensis Brite KEGG Orthology (KO) [BR:dde00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dde03036]     Dde_0980 Chromosome and associated proteins [BR:dde03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Dde_0980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB ADIP THOC7 Macoilin HALZ FlaC_arch OVT1 DUF3450 Mod_r CDC37_N TSC22 YabA bZIP_1 SYCE1 Herpes_UL6 YlqD FlgN DivIC APC_N_CC BRD4_CDT Baculo_PEP_C FUSC TMPIT Ran-binding betaPIX_CC DivIVA DUF6262 YvrJ RSS_P20 Prominin UPF0184 DUF5595 Med21 Motif Other DBs NCBI-ProteinID:  ABB37781 UniProt:  Q313W5 LinkDB All DBs Position complement(1007977..1008240) Genome browser AA seq 87 aa AA seqDB search MHQNGYNSDMELLDRLESRIDSLLTTIEALSEENRRLKEEVDSGLSALADENRELKESLE QERTTREAVLARMDNLLAKLKTHTGEE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcatcaaaatggttacaattccgacatggagctcttagaccggctggaaagccgaatc gattcactacttactaccattgaagcgttgagcgaagaaaaccggcgccttaaggaagaa gtagattcgggcctttctgctttggctgacgaaaacagggaactcaaggagtcgctcgag caggagcgtaccacgcgtgaagccgtactggcgcgcatggacaacctgcttgccaaactg aaaacccataccggggaagaatag

DBGET integrated database retrieval system