Pseudodesulfovibrio mercurii: DND132_1252 Help Entry DND132_1252       CDS       T01709                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ddn  Pseudodesulfovibrio mercurii Pathway ddn00020   Citrate cycle (TCA cycle) ddn00720   Other carbon fixation pathways ddn01100   Metabolic pathways ddn01110   Biosynthesis of secondary metabolites ddn01120   Microbial metabolism in diverse environments ddn01200   Carbon metabolism ddn01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ddn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DND132_1252   09102 Energy metabolism    00720 Other carbon fixation pathways     DND132_1252 Enzymes [BR:ddn01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DND132_1252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_6 Fer4_9 Fer4_16 Fer4_4 Fer4_17 Fer4_8 Fer4_20 Fer4_15 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  EGB14461 UniProt:  F0JCG3 LinkDB All DBs Position 1379256..1379471 Genome browser AA seq 71 aa AA seqDB search MSEKHHVIDARRCKACGLCVDNCPKAVLALGTAINAQGYNYVVQEHPENCVLCDICGTIC PDMAIGVVVDQ NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaaacatcatgtcattgacgcccgccgctgcaaggcctgcgggctttgcgtg gacaactgccccaaggcggttcttgccctcggcaccgcaatcaatgcgcagggatacaac tacgtcgtccaggaacacccggaaaactgcgtactttgcgacatttgcggcaccatctgc cccgacatggccatcggtgtcgtcgtagaccagtaa

DBGET integrated database retrieval system