KEGG   Delphinus delphis (saddleback dolphin): 132435506
Entry
132435506         CDS       T11117                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
ddp  Delphinus delphis (saddleback dolphin)
Pathway
ddp01521  EGFR tyrosine kinase inhibitor resistance
ddp01522  Endocrine resistance
ddp04010  MAPK signaling pathway
ddp04012  ErbB signaling pathway
ddp04014  Ras signaling pathway
ddp04015  Rap1 signaling pathway
ddp04062  Chemokine signaling pathway
ddp04068  FoxO signaling pathway
ddp04071  Sphingolipid signaling pathway
ddp04072  Phospholipase D signaling pathway
ddp04137  Mitophagy - animal
ddp04140  Autophagy - animal
ddp04150  mTOR signaling pathway
ddp04151  PI3K-Akt signaling pathway
ddp04210  Apoptosis
ddp04211  Longevity regulating pathway
ddp04213  Longevity regulating pathway - multiple species
ddp04218  Cellular senescence
ddp04360  Axon guidance
ddp04370  VEGF signaling pathway
ddp04371  Apelin signaling pathway
ddp04519  Cadherin signaling
ddp04540  Gap junction
ddp04550  Signaling pathways regulating pluripotency of stem cells
ddp04625  C-type lectin receptor signaling pathway
ddp04650  Natural killer cell mediated cytotoxicity
ddp04660  T cell receptor signaling pathway
ddp04662  B cell receptor signaling pathway
ddp04664  Fc epsilon RI signaling pathway
ddp04714  Thermogenesis
ddp04720  Long-term potentiation
ddp04722  Neurotrophin signaling pathway
ddp04725  Cholinergic synapse
ddp04726  Serotonergic synapse
ddp04730  Long-term depression
ddp04810  Regulation of actin cytoskeleton
ddp04910  Insulin signaling pathway
ddp04912  GnRH signaling pathway
ddp04915  Estrogen signaling pathway
ddp04916  Melanogenesis
ddp04917  Prolactin signaling pathway
ddp04919  Thyroid hormone signaling pathway
ddp04921  Oxytocin signaling pathway
ddp04926  Relaxin signaling pathway
ddp04929  GnRH secretion
ddp04933  AGE-RAGE signaling pathway in diabetic complications
ddp04935  Growth hormone synthesis, secretion and action
ddp05010  Alzheimer disease
ddp05022  Pathways of neurodegeneration - multiple diseases
ddp05034  Alcoholism
ddp05160  Hepatitis C
ddp05161  Hepatitis B
ddp05163  Human cytomegalovirus infection
ddp05165  Human papillomavirus infection
ddp05166  Human T-cell leukemia virus 1 infection
ddp05167  Kaposi sarcoma-associated herpesvirus infection
ddp05170  Human immunodeficiency virus 1 infection
ddp05200  Pathways in cancer
ddp05203  Viral carcinogenesis
ddp05205  Proteoglycans in cancer
ddp05206  MicroRNAs in cancer
ddp05207  Chemical carcinogenesis - receptor activation
ddp05208  Chemical carcinogenesis - reactive oxygen species
ddp05210  Colorectal cancer
ddp05211  Renal cell carcinoma
ddp05213  Endometrial cancer
ddp05214  Glioma
ddp05215  Prostate cancer
ddp05216  Thyroid cancer
ddp05218  Melanoma
ddp05219  Bladder cancer
ddp05220  Chronic myeloid leukemia
ddp05221  Acute myeloid leukemia
ddp05223  Non-small cell lung cancer
ddp05224  Breast cancer
ddp05225  Hepatocellular carcinoma
ddp05226  Gastric cancer
ddp05230  Central carbon metabolism in cancer
ddp05231  Choline metabolism in cancer
ddp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ddp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ddp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    132435506 (NRAS)
   04012 ErbB signaling pathway
    132435506 (NRAS)
   04014 Ras signaling pathway
    132435506 (NRAS)
   04015 Rap1 signaling pathway
    132435506 (NRAS)
   04370 VEGF signaling pathway
    132435506 (NRAS)
   04371 Apelin signaling pathway
    132435506 (NRAS)
   04068 FoxO signaling pathway
    132435506 (NRAS)
   04072 Phospholipase D signaling pathway
    132435506 (NRAS)
   04071 Sphingolipid signaling pathway
    132435506 (NRAS)
   04151 PI3K-Akt signaling pathway
    132435506 (NRAS)
   04150 mTOR signaling pathway
    132435506 (NRAS)
  09133 Signaling molecules and interaction
   04519 Cadherin signaling
    132435506 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    132435506 (NRAS)
   04137 Mitophagy - animal
    132435506 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    132435506 (NRAS)
   04218 Cellular senescence
    132435506 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    132435506 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    132435506 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    132435506 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    132435506 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    132435506 (NRAS)
   04660 T cell receptor signaling pathway
    132435506 (NRAS)
   04662 B cell receptor signaling pathway
    132435506 (NRAS)
   04664 Fc epsilon RI signaling pathway
    132435506 (NRAS)
   04062 Chemokine signaling pathway
    132435506 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    132435506 (NRAS)
   04929 GnRH secretion
    132435506 (NRAS)
   04912 GnRH signaling pathway
    132435506 (NRAS)
   04915 Estrogen signaling pathway
    132435506 (NRAS)
   04917 Prolactin signaling pathway
    132435506 (NRAS)
   04921 Oxytocin signaling pathway
    132435506 (NRAS)
   04926 Relaxin signaling pathway
    132435506 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    132435506 (NRAS)
   04919 Thyroid hormone signaling pathway
    132435506 (NRAS)
   04916 Melanogenesis
    132435506 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    132435506 (NRAS)
   04726 Serotonergic synapse
    132435506 (NRAS)
   04720 Long-term potentiation
    132435506 (NRAS)
   04730 Long-term depression
    132435506 (NRAS)
   04722 Neurotrophin signaling pathway
    132435506 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    132435506 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    132435506 (NRAS)
   04213 Longevity regulating pathway - multiple species
    132435506 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    132435506 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    132435506 (NRAS)
   05206 MicroRNAs in cancer
    132435506 (NRAS)
   05205 Proteoglycans in cancer
    132435506 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    132435506 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    132435506 (NRAS)
   05203 Viral carcinogenesis
    132435506 (NRAS)
   05230 Central carbon metabolism in cancer
    132435506 (NRAS)
   05231 Choline metabolism in cancer
    132435506 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    132435506 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    132435506 (NRAS)
   05225 Hepatocellular carcinoma
    132435506 (NRAS)
   05226 Gastric cancer
    132435506 (NRAS)
   05214 Glioma
    132435506 (NRAS)
   05216 Thyroid cancer
    132435506 (NRAS)
   05221 Acute myeloid leukemia
    132435506 (NRAS)
   05220 Chronic myeloid leukemia
    132435506 (NRAS)
   05218 Melanoma
    132435506 (NRAS)
   05211 Renal cell carcinoma
    132435506 (NRAS)
   05219 Bladder cancer
    132435506 (NRAS)
   05215 Prostate cancer
    132435506 (NRAS)
   05213 Endometrial cancer
    132435506 (NRAS)
   05224 Breast cancer
    132435506 (NRAS)
   05223 Non-small cell lung cancer
    132435506 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    132435506 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    132435506 (NRAS)
   05161 Hepatitis B
    132435506 (NRAS)
   05160 Hepatitis C
    132435506 (NRAS)
   05163 Human cytomegalovirus infection
    132435506 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    132435506 (NRAS)
   05165 Human papillomavirus infection
    132435506 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    132435506 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    132435506 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    132435506 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    132435506 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    132435506 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    132435506 (NRAS)
   01522 Endocrine resistance
    132435506 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddp04131]
    132435506 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddp04147]
    132435506 (NRAS)
   04031 GTP-binding proteins [BR:ddp04031]
    132435506 (NRAS)
Membrane trafficking [BR:ddp04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    132435506 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    132435506 (NRAS)
Exosome [BR:ddp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   132435506 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   132435506 (NRAS)
  Exosomal proteins of breast cancer cells
   132435506 (NRAS)
  Exosomal proteins of colorectal cancer cells
   132435506 (NRAS)
GTP-binding proteins [BR:ddp04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    132435506 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 132435506
NCBI-ProteinID: XP_059883608
LinkDB
Position
1:complement(100482123..100492793)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattgccatgtgtagtgatgtaa

DBGET integrated database retrieval system