KEGG   Delphinus delphis (saddleback dolphin): 132438343
Entry
132438343         CDS       T11117                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
ddp  Delphinus delphis (saddleback dolphin)
Pathway
ddp04010  MAPK signaling pathway
ddp04014  Ras signaling pathway
ddp04015  Rap1 signaling pathway
ddp04024  cAMP signaling pathway
ddp04062  Chemokine signaling pathway
ddp04071  Sphingolipid signaling pathway
ddp04145  Phagosome
ddp04148  Efferocytosis
ddp04151  PI3K-Akt signaling pathway
ddp04310  Wnt signaling pathway
ddp04360  Axon guidance
ddp04370  VEGF signaling pathway
ddp04380  Osteoclast differentiation
ddp04510  Focal adhesion
ddp04517  IgSF CAM signaling
ddp04518  Integrin signaling
ddp04519  Cadherin signaling
ddp04520  Adherens junction
ddp04530  Tight junction
ddp04613  Neutrophil extracellular trap formation
ddp04620  Toll-like receptor signaling pathway
ddp04650  Natural killer cell mediated cytotoxicity
ddp04662  B cell receptor signaling pathway
ddp04664  Fc epsilon RI signaling pathway
ddp04666  Fc gamma R-mediated phagocytosis
ddp04670  Leukocyte transendothelial migration
ddp04722  Neurotrophin signaling pathway
ddp04810  Regulation of actin cytoskeleton
ddp04932  Non-alcoholic fatty liver disease
ddp04933  AGE-RAGE signaling pathway in diabetic complications
ddp04972  Pancreatic secretion
ddp05014  Amyotrophic lateral sclerosis
ddp05020  Prion disease
ddp05022  Pathways of neurodegeneration - multiple diseases
ddp05100  Bacterial invasion of epithelial cells
ddp05132  Salmonella infection
ddp05135  Yersinia infection
ddp05163  Human cytomegalovirus infection
ddp05167  Kaposi sarcoma-associated herpesvirus infection
ddp05169  Epstein-Barr virus infection
ddp05170  Human immunodeficiency virus 1 infection
ddp05200  Pathways in cancer
ddp05203  Viral carcinogenesis
ddp05205  Proteoglycans in cancer
ddp05208  Chemical carcinogenesis - reactive oxygen species
ddp05210  Colorectal cancer
ddp05211  Renal cell carcinoma
ddp05212  Pancreatic cancer
ddp05231  Choline metabolism in cancer
ddp05415  Diabetic cardiomyopathy
ddp05416  Viral myocarditis
ddp05417  Lipid and atherosclerosis
ddp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ddp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    132438343 (RAC1)
   04014 Ras signaling pathway
    132438343 (RAC1)
   04015 Rap1 signaling pathway
    132438343 (RAC1)
   04310 Wnt signaling pathway
    132438343 (RAC1)
   04370 VEGF signaling pathway
    132438343 (RAC1)
   04071 Sphingolipid signaling pathway
    132438343 (RAC1)
   04024 cAMP signaling pathway
    132438343 (RAC1)
   04151 PI3K-Akt signaling pathway
    132438343 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    132438343 (RAC1)
   04518 Integrin signaling
    132438343 (RAC1)
   04519 Cadherin signaling
    132438343 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    132438343 (RAC1)
   04148 Efferocytosis
    132438343 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    132438343 (RAC1)
   04520 Adherens junction
    132438343 (RAC1)
   04530 Tight junction
    132438343 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    132438343 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    132438343 (RAC1)
   04620 Toll-like receptor signaling pathway
    132438343 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    132438343 (RAC1)
   04662 B cell receptor signaling pathway
    132438343 (RAC1)
   04664 Fc epsilon RI signaling pathway
    132438343 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    132438343 (RAC1)
   04670 Leukocyte transendothelial migration
    132438343 (RAC1)
   04062 Chemokine signaling pathway
    132438343 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    132438343 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    132438343 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    132438343 (RAC1)
   04380 Osteoclast differentiation
    132438343 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    132438343 (RAC1)
   05205 Proteoglycans in cancer
    132438343 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    132438343 (RAC1)
   05203 Viral carcinogenesis
    132438343 (RAC1)
   05231 Choline metabolism in cancer
    132438343 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    132438343 (RAC1)
   05212 Pancreatic cancer
    132438343 (RAC1)
   05211 Renal cell carcinoma
    132438343 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    132438343 (RAC1)
   05163 Human cytomegalovirus infection
    132438343 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    132438343 (RAC1)
   05169 Epstein-Barr virus infection
    132438343 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    132438343 (RAC1)
   05135 Yersinia infection
    132438343 (RAC1)
   05100 Bacterial invasion of epithelial cells
    132438343 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    132438343 (RAC1)
   05020 Prion disease
    132438343 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    132438343 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    132438343 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    132438343 (RAC1)
   05415 Diabetic cardiomyopathy
    132438343 (RAC1)
   05416 Viral myocarditis
    132438343 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    132438343 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    132438343 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddp04131]
    132438343 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddp04147]
    132438343 (RAC1)
   04031 GTP-binding proteins [BR:ddp04031]
    132438343 (RAC1)
Membrane trafficking [BR:ddp04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    132438343 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    132438343 (RAC1)
  Macropinocytosis
   Ras GTPases
    132438343 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    132438343 (RAC1)
Exosome [BR:ddp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   132438343 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   132438343 (RAC1)
  Exosomal proteins of colorectal cancer cells
   132438343 (RAC1)
  Exosomal proteins of bladder cancer cells
   132438343 (RAC1)
GTP-binding proteins [BR:ddp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    132438343 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 132438343
NCBI-ProteinID: XP_059888434
LinkDB
Position
15:83392350..83413542
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctcctg
atcagttatacgaccaatgcctttcctggagagtatatccccactgtcttcgacaactat
tctgccaatgttatggtggatggaaaaccggtgaatctgggcttgtgggatacagctgga
caagaagattatgaccgattacgtcccctatcctatccgcaaacggatgtattcttgatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtaccctgaa
gtgcgacaccactgtcccaacactcctatcatcctggtggggacgaaacttgatctgagg
gatgataaagacacgattgagaaactgaaggagaagaagctgacacccatcacctacccg
cagggcttggccatggccaaggagatcggtgccgtcaaatacctggagtgctcggcgctc
acgcagcgaggtcttaagacggtgtttgatgaagctatccgggcggttctctgcccgccc
cccgtcaagaagaggaagagaaaatgcctgctgttgtga

DBGET integrated database retrieval system