KEGG   Dickeya dianthicola: DDI_2759
Entry
DDI_2759          CDS       T05141                                 
Name
(GenBank) Putative transporting ATPase
  KO
K09906  elongation factor P hydroxylase [EC:1.14.-.-]
Organism
ddq  Dickeya dianthicola
Brite
KEGG Orthology (KO) [BR:ddq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ddq03012]
    DDI_2759
Translation factors [BR:ddq03012]
 Prokaryotic type
  Elongation factors
   DDI_2759
SSDB
Motif
Pfam: EpmC Mg296
Other DBs
NCBI-ProteinID: ATO33927
LinkDB
Position
complement(2855889..2856452)
AA seq 187 aa
MTMLTDTASTHHYDQLITVFNRCFSEEYHTRLVKGDDEPIYLPADDQAPYHRIVFAHGFY
ASAMHEISHWCIAGEARRKVVDFGYWYCPDGRDAATQSQFESVEIKPQALEWMFCVAAGF
PFNVSCDNLNGDVDPDRIAFQRRVHAQVMMYLQQGVPSRPARFIQALRDFYHTAPQTAAD
FPYPADL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgacgatgttgaccgacactgcaagcactcaccattacgaccagttgatcaccgttttc
aaccggtgttttagcgaggaataccacacccggctggtgaagggcgacgatgagcctatc
tacctgccggccgacgatcaggcgccgtatcaccgcattgtgtttgcgcacgggttctat
gccagcgccatgcacgagatttcgcactggtgcattgccggtgaagcgcggcgcaaagtg
gtggacttcggctactggtattgcccggacggacgcgatgccgcgacccagagccagttt
gagtcggtggaaatcaagccgcaggcgctggagtggatgttctgcgtggccgccggcttc
ccgtttaatgtcagctgcgacaacctgaatggcgacgttgacccggaccgtatcgctttc
cagcgccgggtacacgcgcaggtgatgatgtatctgcaacagggcgtgcccagccggccg
gcgcgctttattcaggcgctgcgagacttttaccacacggcgccgcaaaccgcggcggac
tttccttacccggccgatctgtga

DBGET integrated database retrieval system