KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0187
Entry
Ddes_0187         CDS       T00837                                 
Name
(GenBank) two component, sigma54 specific, transcriptional regulator, Fis family
  KO
K07713  two-component system, NtrC family, response regulator HydG
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dds00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ddes_0187
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dds02022]
    Ddes_0187
Two-component system [BR:dds02022]
 NtrC family
  HydH-HydG (metal tolerance)
   Ddes_0187
SSDB
Motif
Pfam: Sigma54_activat Response_reg Sigma54_activ_2 HTH_8 AAA_5 Mg_chelatase AAA HTH_50 AAA_16 AAA_19 AAA_2 AAA_22 HTH_30 FleQ ATPase TIP49 MCM NAD_binding_3 AAA_3 HTH_28 nSTAND3 HTH_23 AAA_7 DUF3829_2nd AAA_30 APS_kinase
Other DBs
NCBI-ProteinID: ACL48105
UniProt: B8J2L7
LinkDB
Position
236171..237544
AA seq 457 aa
MKNSILVVDDDDAHRGMLRTMLRSWDYVVEEAADGDEAVALVREKAFDAVLTDVRMARMN
GIHALKGILAYNPALPVILMTAYSSVETAVEALRLGAYDYLVKPLDFESLKHSLQQGIER
SRLSVENRELRRQLSHAAAMPGIIGRSPAIRAMQEIMDTVAPTEATVLITGESGTGKELV
ARALHGKSLRADKPLVTVNCAALAENLLESELFGHEKGSFTGAERRREGRFAQAHGGTLF
LDEVGEMPLSLQAKLLRALQQGEVQRVGSDTQLTVDVRVLAATNRDLRHEVAHRRFREDL
FFRLNVISVEVPPLRERAEDIPVLAAYFLENFASRNRKAVRGFSAQALDIMLRHSWPGNV
RELENAVERAVILCTGDLITARELPSVLSETVAAAEAPAEAPAEADLSLAGLPLDEVERR
VIEETLRQTGDNKSEAARRLGITRATLHNKLRKYELE
NT seq 1374 nt   +upstreamnt  +downstreamnt
gtgaagaacagcattcttgtagtggacgatgacgacgcgcaccgcggtatgctgcgaacc
atgcttcgttcctgggactatgtggtggaggaggctgccgacggcgatgaggcggtggct
cttgtacgggaaaaggcctttgacgccgtgctgaccgacgtgcgcatggcgcgcatgaac
ggcatacacgcgctcaaggggattcttgcatataatcccgcgctgcctgtcattctcatg
acggcgtattcctcggtggaaacagccgtggaggctttgcgcctgggggcgtatgactat
ctggtcaagcctctggactttgaaagcctgaagcattccttgcagcaaggcattgagcgt
tcgcgcctgagtgtcgaaaatcgcgaactgcgccgtcagttgagtcacgcggcggccatg
cccggcattatcggccgcagtccggccattcgcgccatgcaggaaatcatggataccgtg
gcccccaccgaagccacggtgctcattaccggcgagtcgggaaccggcaaggagctggtg
gcccgcgccctgcacggcaaaagcctgcgcgccgataaaccccttgttaccgtcaactgt
gcggctctggcggaaaacctgctggaatcagaattgttcgggcatgaaaaaggctcgttc
accggtgcggagcgccgtcgcgaggggcgctttgcccaggcgcacggcggcacgctcttt
ctggacgaagtgggtgagatgcccctttcgcttcaggccaagctgctgcgtgccctgcag
cagggtgaggtgcagcgcgtaggctctgacacgcagctcactgtggatgtgcgcgtactg
gccgccaccaaccgtgacctgcggcatgaggtggcgcacaggcgttttcgcgaagacctg
tttttccgcctgaatgtcatcagtgttgaagtgccgcccctgcgtgaaagggcagaagac
attcctgtgctggcggcatattttctggaaaattttgccagtcgtaaccgcaaggccgtg
cgcgggttttccgcgcaggcgcttgacatcatgctgcggcattcctggccgggcaatgtg
cgcgaactggaaaatgccgtggagcgggctgttattctctgcaccggcgaccttatcacc
gcgcgcgaactgccctctgtgctgtctgaaaccgttgcggcggcagaagctccggcggaa
gctccggcagaagcggatctttctctggcgggtctgcccctggatgaggtggagcgccgg
gtcattgaggaaaccctgcgccagaccggcgataacaagagtgaggccgcgcgccgcctg
ggcattacccgcgccaccctgcacaacaagctgcgcaagtacgagcttgaataa

DBGET integrated database retrieval system