KEGG   Denitrobacterium detoxificans: AAY81_04215
Entry
AAY81_04215       CDS       T04382                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
ddt  Denitrobacterium detoxificans
Pathway
ddt00770  Pantothenate and CoA biosynthesis
ddt01100  Metabolic pathways
ddt01240  Biosynthesis of cofactors
Module
ddt_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ddt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AAY81_04215 (coaD)
Enzymes [BR:ddt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     AAY81_04215 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: ANE22460
UniProt: A0A172RXL1
LinkDB
Position
1016317..1016826
AA seq 169 aa
MKRALVPGTFDPITEGHLDIIRRASQIFDEVIVAVAASPNKGGRSRLFTLEERVELARKS
VADIPNVRVEPFSELLVSFARRMDAKVLVKGLRAITDFEYEFQMTAMNYDIDREVETVFI
MSPPKYMYLSSSIVREIASLGGPFREFVSDPVYRALCEKYDLPLNEQGE
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaaacgcgcgctcgtgcccggcacattcgaccccattacggaagggcatctggacatc
atccgccgtgcttcccagatcttcgatgaggtgatcgttgccgtggccgcttcgcccaac
aagggcggtcgcagcaggctcttcacgctcgaggagcgtgtcgagctggctcgcaagtcg
gttgccgacattccgaatgtgcgcgtcgagccctttagcgagctgctcgtttcgttcgcg
cgtcgcatggatgcgaaggttctggtgaagggcctgcgggctatcaccgacttcgaatac
gagttccagatgactgctatgaactacgacattgaccgcgaagtcgaaaccgtgttcatc
atgtcgcccccgaagtacatgtacctctcgtcttccatcgtgcgagaaattgccagcttg
ggtgggccgttccgcgagttcgtttccgatccggtctatcgcgcgctttgcgaaaagtac
gatttgcccctcaatgagcagggcgaatag

DBGET integrated database retrieval system