KEGG   Desulfolithobacter dissulfuricans: GF1_07040
Entry
GF1_07040         CDS       T08652                                 
Name
(GenBank) aspartate aminotransferase
  KO
K11358  aspartate aminotransferase [EC:2.6.1.1]
Organism
ddu  Desulfolithobacter dissulfuricans
Pathway
ddu00220  Arginine biosynthesis
ddu00250  Alanine, aspartate and glutamate metabolism
ddu00270  Cysteine and methionine metabolism
ddu00330  Arginine and proline metabolism
ddu00350  Tyrosine metabolism
ddu00360  Phenylalanine metabolism
ddu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddu00401  Novobiocin biosynthesis
ddu01100  Metabolic pathways
ddu01110  Biosynthesis of secondary metabolites
ddu01210  2-Oxocarboxylic acid metabolism
ddu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ddu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GF1_07040
   00270 Cysteine and methionine metabolism
    GF1_07040
   00220 Arginine biosynthesis
    GF1_07040
   00330 Arginine and proline metabolism
    GF1_07040
   00350 Tyrosine metabolism
    GF1_07040
   00360 Phenylalanine metabolism
    GF1_07040
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GF1_07040
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    GF1_07040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ddu01007]
    GF1_07040
Enzymes [BR:ddu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     GF1_07040
Amino acid related enzymes [BR:ddu01007]
 Aminotransferase (transaminase)
  Class I
   GF1_07040
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase NOT1_connector ARM_Cnot1
Other DBs
NCBI-ProteinID: BCO08328
UniProt: A0A915TYW3
LinkDB
Position
827903..829084
AA seq 393 aa
MSVSKKMQMFAEKSSWIRKMFEEGARMKAEFGDEKVFDFSLGNPDVPPPPRFTEVLRELV
EEDRPGMHAYMPNGGLPWVREALAAKLSQEQGVEIGAGEVLMTCGAAGALNVVMKALLDP
GDEVIILSPFFVEYNFYVDNHGGQTKIVPTDEEFCLDLGAIEAALSEKTKAVLINSPNNP
TGQVYSRESLAALGRLLDEAGEKFCTTIYLISDEPYRKIVFDDCEVPSIMEATDNSIVVS
SYSKDLSLPGERIGYLAVHPEIFEKTMLLDALTLANRILGFVNAPALMQRVVERLQDETV
DTSIYARRREIFCRVLDEAGFEYVRPRGAFYLFPKTPIDDVEFCGLLQEEKILAVPGRGF
GAPGYIRLAFCVPDDVIERSADGFKRAMEKCRR
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgtcagtttccaagaagatgcagatgtttgcggaaaaatcgtcctggatccgcaagatg
tttgaagagggcgcccggatgaaggcggagttcggtgatgagaaagtgtttgatttttcc
ctgggcaaccccgatgttccgccgccgcccaggttcaccgaggttttgcgggaactggtg
gaggaagacaggcccgggatgcatgcctacatgccaaacgggggccttccctgggtccgt
gaggccctggccgccaaattgtcccaggagcagggggtggagatcggtgccggagaggtg
ctcatgacctgtggggcggccggagcgctcaacgtggtgatgaaggccctgcttgatccc
ggcgacgaggtgatcatcctgtcgccgttttttgtcgaatacaatttctatgtcgacaac
cacgggggccagacaaagattgtgcccaccgacgaggagttctgtctcgacctcggggcc
atcgaggccgcactgtccgaaaagaccaaggccgtgctgatcaacagccccaacaatccc
accgggcaggtctattcccgggagtccctggccgcgctcgggcggctcctggatgaggcc
ggcgagaagttctgcaccaccatctacctgatctccgacgaaccgtaccgcaagatagtc
tttgatgactgtgaagtgccctcgatcatggaggccacggataactccattgtggtctca
tcctattccaaggatctttctctgcccggcgagcggatcggctacctggccgtgcatccg
gagatttttgaaaagaccatgctgctcgacgccctgaccctggccaatcggatccttggc
tttgtcaatgccccggccctgatgcagcgggtggtggaacggctccaggacgagaccgtg
gatacctctatctatgcccgaaggcgggagatcttctgcagggttctcgacgaggccggg
tttgagtatgtccggcccaggggtgccttttatctctttcctaaaacgcccatcgatgat
gtggagttctgtggtctgctgcaggaggagaagatccttgccgtcccgggtcgcgggttc
ggggcgccgggctatatccgcttggccttctgcgtgcccgatgacgtgatcgagcgctcg
gcggacggtttcaagcgggccatggagaagtgccggcgctga

DBGET integrated database retrieval system