Desulfolithobacter dissulfuricans: GF1_10300 Help Entry GF1_10300         CDS       T08652                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ddu  Desulfolithobacter dissulfuricans Pathway ddu01100   Metabolic pathways ddu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ddu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GF1_10300 (acpP)    00074 Mycolic acid biosynthesis     GF1_10300 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GF1_10300 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  BCO08654 UniProt:  A0A915TZH9 LinkDB All DBs Position 1167722..1167952 Genome browser AA seq 76 aa AA seqDB search MAVEDKMIDIIVEQLSVDRDKVVPGASFVDDLGADSLDLVELIMAMEEEFDVEIPDEEAE KIATVQDAIDYVNKLK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcagttgaagacaaaatgatcgatatcatcgttgagcagctcagtgtagaccgggat aaggtcgtacccggtgcctcctttgtcgatgacctcggagccgattccctggatctggtt gagctgatcatggccatggaagaagaattcgacgtggaaattcccgacgaagaggcggaa aagatcgccacggttcaggatgccatcgattatgtcaataaactgaagtag

DBGET integrated database retrieval system