Desulfolithobacter dissulfuricans: GF1_24540 Help Entry GF1_24540         CDS       T08652                                  Name (GenBank) hypothetical protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ddu  Desulfolithobacter dissulfuricans Pathway ddu01100   Metabolic pathways ddu01120   Microbial metabolism in diverse environments ddu01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:ddu00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     GF1_24540    00622 Xylene degradation     GF1_24540    00621 Dioxin degradation     GF1_24540 Enzymes [BR:ddu01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      GF1_24540 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  BCO10078 UniProt:  A0A915XL31 LinkDB All DBs Position complement(2724128..2724313) Genome browser AA seq 61 aa AA seqDB search MPYVSIRVAGKLSRKQKKKIARGVTDVIAKAANKPKESILIFIDEESRENIASGGVLLDE K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgccctacgtatccatccgtgtcgcgggaaagttgagccgcaagcagaaaaagaaaatc gccaggggcgtgacggacgtcattgccaaggcggccaacaaacccaaggagtccatcctg atcttcatcgatgaagaaagcagggagaatatcgccagtggcggtgttctgctcgacgaa aaatag

DBGET integrated database retrieval system