Devosia ginsengisoli: FPZ08_03190 Help Entry FPZ08_03190       CDS       T06120                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dea  Devosia ginsengisoli Pathway dea01100   Metabolic pathways dea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPZ08_03190    00074 Mycolic acid biosynthesis     FPZ08_03190   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPZ08_03190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  QDZ09834 UniProt:  A0A5B8LQD0 LinkDB All DBs Position 645802..646038 Genome browser AA seq 78 aa AA seqDB search MSDVADRVRKIVVEHLNVDAEKVVEKASFIDDLGADSLDQVELVMAFEEEFSVEIPDDAA ESIQTFGDAVSFLTKAVG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgctgatcgggtccgcaagatcgttgtggaacacctcaatgtggatgcc gagaaggttgtcgaaaaggccagcttcatcgacgatctgggtgcggactccctcgaccag gtcgaactggtgatggccttcgaagaagaattttcggttgagatccccgacgacgccgcc gagtcgatccagaccttcggcgatgccgtgtcgttcctcaccaaggccgtcggctaa

DBGET integrated database retrieval system