Devosia ginsengisoli: FPZ08_05535 Help Entry FPZ08_05535       CDS       T06120                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism dea  Devosia ginsengisoli Pathway dea02024   Quorum sensing dea03018   RNA degradation Brite KEGG Orthology (KO) [BR:dea00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     FPZ08_05535 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     FPZ08_05535 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:dea03019]     FPZ08_05535 (hfq)    03036 Chromosome and associated proteins [BR:dea03036]     FPZ08_05535 (hfq) Messenger RNA biogenesis [BR:dea03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      FPZ08_05535 (hfq) Chromosome and associated proteins [BR:dea03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     FPZ08_05535 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  QDZ10253 UniProt:  A0A5B8LQ04 LinkDB All DBs Position complement(1144173..1144424) Genome browser AA seq 83 aa AA seqDB search MANEKQQNLQDSFLNHVRKQKVPVTIFLVNGVKLQGVITWFDNFCLLLRRDAQSQLVYKH AISTIMPGAPIQLFDPEQNHDSD NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcgaacgaaaaacaacaaaatctgcaggattcctttctcaaccacgttcgcaagcag aaagtaccggtcacgatctttctcgtgaacggggtgaaactgcagggcgtgatcacctgg ttcgacaatttctgcctgctgctgcgccgcgacgcgcagtcgcagctggtctacaagcac gcgatctcgaccatcatgccgggtgcgccgatccagctgttcgatcccgagcagaaccac gacagcgactga

DBGET integrated database retrieval system